PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 476091
Common NameARALYDRAFT_476091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 397aa    MW: 43887.5 Da    PI: 9.0438
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
476091genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.5e-38125184261
  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
             ++k l+cprC+s+ntkfCyynny+++qPryfC++C+ryWt+GG++rnvPvG+grrknk +
  476091 125 PDKLLPCPRCESANTKFCYYNNYNVNQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKNKGW 184
             78999****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30122182IPR003851Zinc finger, Dof-type
PfamPF027011.6E-31127182IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.537129183IPR003851Zinc finger, Dof-type
PROSITE patternPS013610131167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MSKSIDREIK LFGRTITSLL DVNRYDPSSL SHVHDVSSDQ SKEDSSSSSS SCSPTIGPIK  60
VPANKSDQES NRFKDPYILS DLNEPPKAVS EISSPRSSKN NCDQQSEITT TSTTSGEKST  120
ALKKPDKLLP CPRCESANTK FCYYNNYNVN QPRYFCRNCQ RYWTAGGSMR NVPVGSGRRK  180
NKGWASSNHY LQVTSEDCDN NNSGTILSFG SSESSVTEAG KHQSRDTTKI SADSVSQEHK  240
TYQGFLPPQV MLPNNSSPWP YQWSPTGPNA SFYPVPFYWG CTVPIYPTSE TSPCLGKRSR  300
DQTEGRINDT NTTITTTRAR LVSEPLKMNS EATKSAVWSK LPTKPEKKTQ GFSLFNGFDT  360
KGNSNRSSLV TETSHSLQAN PAAMSRAMNF RESMQQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00223DAPTransfer from AT1G69570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1763460.0AK176346.1 Arabidopsis thaliana mRNA for putative H-protein promoter binding factor-2b, complete cds, clone: RAFL24-04-C08.
GenBankBT0256230.0BT025623.1 Arabidopsis thaliana At1g69570 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888724.10.0hypothetical protein ARALYDRAFT_476091
SwissprotQ9SEZ30.0CDF5_ARATH; Cyclic dof factor 5
TrEMBLD7KXG90.0D7KXG9_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.2__1221__AT1G69570.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130901729
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69570.10.0Dof family protein